The Central Guardian

rm; cnARwrrs-rowiw GUARDIAN

This column is - renewed for sen o! loesl interest but advertising of

consensus-iron cum m-

AMXNZiNc

PAGE 'I'HREE

I newly nature ml! be inserted It l SUBANCE L'"”'7'u':12 coats s word strictly payable in sil- --—--- _ ' "m- " srswsnrs mssr rrreiree het- ‘ , p . m hreed. issi-e-ic-u WHI I E FISH MEAL °“"““‘-‘i‘l‘°‘°“"“ mrmynyg~-og*gg=>==; ‘ nss "sourrr shortening for w' k f’ Le . ‘i m ° ° It is important to realize that FASTERFAT M" bww- who-uni °’ ' a ' P‘ “ °“‘,‘,‘.",‘§”;,‘.ff3§3.,,_ ~

.Whlte Fish Meal is made solely from the flesh

. Now roasassnaaa "*- and bones of such fish as are described in the With swim Hood Poi-ridangfi: °,:N§:$:c§°;1'gf°i":§h;,‘g:f trade as “White Fish”, a category that in- cludes cod, haddock, hakc, whiting and other

China. Silverware or Plain. OONMDEBATION LIFE IN-

lsy. Covers the course concisely. Twenty-ﬁve cents. postal note or

KIND OE

‘THE NEW 1938

fish containing a low percentage of oil. All soasnos L-s-ist-i-iz-siz win’ c‘ F‘ “me” °f,‘.”“°‘f°°‘f'.',f stronsl! flavored end oily material such r. r. ___ m” “ ‘ “~ AUTQMATIC TUNING derived min fish of the herring and mackerel ,,",,°°°,m§§“§3ﬂﬁ3§8 ,,f,°'.,,,,;f{g 051131231! wﬂvwosr-Nrw 01n- Wlles l9 rigidly excluded- November ‘ziird. Phone 583. girl; in lath?‘ ‘Igiasteirsl , L-im-n-zo-ii. Church a.oo PM. Rev.Wm.G. Quig- o

FASTERFAT White Fish Meal. therefore. is manufactured from those portions of white fish which are not used for human consump- lion. The gutting process is carried out at sea,

the entrails being thrown overboard. From this mm Ind “ms prim rknected. November 110th alter smell sc-" it will be appreciated that these parts of the 1"m°7‘11'15'°l- “mm” m" bee" dimfgajzilin m u '

fish never appear in the raw material from which “FASTERFAT” is made.

We have just received a carload of the above feed for farm animals, which is guaranteed 709'. protein _ Try out a sample bag and be convinced oi‘ the high quality feeding value -- Selling at lowest prices — Wholesale and Re- tail —- by

A. HORNE f? CO. ’

CHARLOTTETOWN

3W6 Gt’: DGQMHQIJDQ I‘! U-ﬂ“‘-"f~*i‘.'-r‘ﬁ'w’.‘ lilﬁliiﬁdiitﬁlfi

Central Christian Church

i i

mrjvsngrYYl

gsrwsrk .r

MINISTER: REV. S. C. COOPER. ORGANIST: MRS. V. L. DING WELL.

Organist: Mrs. V. L. Dinﬂycll,

God."

Commandment." ALI. OORDIALLY INVITED

Minister: Ilev. 8.0. Cooper, TlnM.

Scrmon-"An Egyptian Mum.

S c r m o n — "The Revolutionary

CIIARLOTTETOWN Fur Bales require 8000 or more good colored half to full silvers by Nov. 22nd. Liberal advances paid, quick re-

SEBVICE in the Mhrshileld Bap- tist Church, Sunday evening, Nov- ember 21st st 8.30 o'clock

L-l263—l1-20-1i.

PLEASURE CRUISE Financial Statement will be ready for Per- usal to any one interested on November 30th after small ac- counts have been cleaned up

' 1r-l2B'l-11-20-1i.

FEEDING FOXES FOR. "COL- OUltW-The colour and sheen of the fur largely determines the price you get for the pelt. Feed Ross- Miller Vita-Crumble “A" (Redd) if you want the best in colour and sheen.

FINED I-‘OII. SHOOTING ON SUNDAY-The adjourned ossc of the Mount Stewart resident charg- ed with Sunday shooting came up tor sentence before Magistrate George J. Tweedy yesterday mom- lng. A ﬁne of $10.00 and costs or 20 days was imposed. The case was prosecuted by the R.C.M.P.

Reynolds, at. St. Peters and Murray Harbour on the following dates: St. Peters (C. S. DlngwelPs Store) November 19th: Murray 311N111

FOX PEI/IS for shipment to

“vow; u n u nun: u u u n n u || n Km. n u )1 n u n n n r r4 u .4 M n re rr n w rm n n re n» er u

Zion Presbyterian Church

I l I I I I I X X I I X I I I I I I I l I 1 l z X X X I I l I f X é

the London December Sale should be sent in to us as soon as p05- sible. The bulk of our shipment-s for this sale will so forward the first. of next. week, and the pelts must be received by Saturday in order to give us sufficient time to clear and lot them. Pelts for the last shipment to the sole must be in our hands not later than Fri-

ley, Minister. 11-1266-11-30-11.

PLEASURE CRUISE Fl- ' ‘

Statement will be ready for Per- usal to any one interested on

NORTH, RIVER. BAPTIST SEB- VICES for Novemiber 21st. Minis- ter: Rev. B. G. Manmr, 11.00 AM. Worship with Communion at North Rivei. 3.0 P .M. Worship with Com- munion at Clyde River 7.00 P. M. Worship at Kingston with 0cm- munlon. You are welcome.

L-1272-11-20-1i.

CARD PARTY ENJOYED — A vcry successful auction party was hcid at the home of Mr. and Mrs. John E. Mulligan, Emerald, on Nov. i7. Two hours were pleasantly spent ln card playing. The results were: liuiies prize won by Mrs. John J. White and gents prize won by Harold MbCourt. The remainder of the evening was whiled away in dancing and e. dainty lunch was served by the ladies of the section.

RETURNS FROM HOLIDAY TRIP-Rev. Dr. FA. Wlghtman has returned to Fredericton alter spending the past month in Prince Edward island and Nova. Scotla. Ho visited a son, Ralph Wlghtma-n

Wightmen, 1n Kentville, N. 5., and a brother, George Wiglitman in Dgby-Fredericton Gleaner.

ed over the city on its return to Boston late the same afbernoon.— Saint John Telegraph Journal.

FUNERAL SERVICES-Title fun- eral oi’ Patrick Duffy took place yesterday morning from his late residence to St. Patric/Ks Church, Fort Augustus and was largely at- tended. The pail bearers were Messrs. John Hcgarty, John Web- ster, Peter Holland, Joseph Duffy,

Come in and TRY this new 193B Double-X Philco! Note that the call letters of your favorite stations are right on the Cone-Centric dlsi. 0m- swing of the pointer and ' ly you get the station of your choice... perfectly tuned for finest reception. That's Philco Automatic Tuning! And Phllco‘; Inclined Control Panel enables you tn tune With case- and grace, whether you're sitting or standing.

And thaifs not all Phllco’: Inclined Sounding Board gives new tone perfection. Philco's Foreign Tuning System doubles the foreign stations you can get and enjoy. No wonder we call the Double-X Philco an amazing NEW KIND of radio! Decide now to own one, Weq| Install It in your home for as little as — - -- - -

'4' DOWN

Another Great VALUE!

‘ PIIILCO CIDF’ Your Ildlt) dol-

lar never bought more! Think oi

it. . .2. full-size Domestic and

. Foreign Console Philco with such » features as Philco Foreign Tuning

mernhr; Service moo s. In. Fox PELTB will be received for in Charlottetown, P. E. 1.. another i shlmnent by our renrewntoﬂveﬁ son, Cecil Wightman, in Monta- 5mm» “"1”! Dill» 2 Tm“ 5min Anthcm-"The Heart of Milton G. Mellish and MBHhI-ll gue, P. E. 1.; another sun, 05mm Ranges, Z-Point Tone Control,

oversize Electra-Dynamic Speaker

and many others, 3 foronly-———-—8 .95

Charlottetown I

PHI

PIIILOO CIXX‘ Look at. these features! Inclined Control Panel, Cone-Centric Automatic Tuning, Inclined Sounding

mic‘: Message." (O. H. Horton's Store) November 315mm,; AT SAINT Jomq_A no d. C n G d speaker 34.0,“, Tom, cum

5 s h ' 12nd. Cash advances will be tl-ven 'pla.ne of the Inter-City Airlines of trot’ pulls? For-ﬁr Tuning, System. 2 Tuning

‘"1 Y 5°11”! M" out own delivery o! m W1" t“ Boston stooped over er. the munl- Ranges, B-Specd Tuning. Beautiful hrnri-rrririred

gvenlng sq-ﬂu. 7.00 Kr ‘sprain? agzllneilgnporbbefior rezuemdgin he? walnut cabinet with protective back g M“. . u h .,. Deizlcxrlmher Sadie in London. The Do- Chaylopfgtilyyn, gfelihplgceﬁrvitll; it: shield. All yours for only - - - - “ s ‘ “F”- T °" K“"'°" '-°"‘ minion Silver m: mus. united. single passenger. The ‘plane, piloted LIBERAL TRADE IN viLmwANCg. ~srid only with rhnen lllirh-Eillc- nouh _ Surnmerslde. L1757'11‘13'2l by “Mil-ie" Harlow of Boston, roar- ' ‘ ' iency Aerial to Insure H0119"-

foreign reception — - — - $7.00

- . l ‘ < r I V’ t‘ . . REV’ G’ CAMXLE WEBSTER "' WNISTER’ hiihsilslfm Furszsth‘ The tIeJr-‘lamln- giilgxgihl-liigéallilyMﬁ gillieiéiliildniray The? {filer nlivigoseivkilwi g-ithmileadetigl weurlidjnclglpvaxf: guukzzwzixrvrwm ‘JWWwA-tuuuuoooootorngzyc g ' ' _ ‘ , i I llll li- J5 (ll irll l Cl 'li.h C" OF ENGIIA. .' , r-wr- new» nrnenrsocorr-rre shim-err é crisis: :"."°“".....:..s:;“.:.;::.': "" """"""" 0'

' " Fr is M 1d, ub d on. d1 is! ti n 1 t1 lin s d l i tterse cialy relat- .

MORNING WORSHIP 5mm" s"°wE"—‘ m“ gov. glee. crzigrlaorrigeted ﬁothe ecerfrinnay ‘Kiri: rife eel: ilrilg iesliiiiife‘ ‘ilarcvinceipel-lon. .1. P. Q i) r -

v~ ». MORNING MUSIC “umber ‘if friend‘ m“ M’ the grave. of securities. The conference will McIntyre will be Acting Premier o S 11.00 a. m. Theme: "Imcsdver- h°m° o! Mm “N15” cudmwe’ be held under the Department oi during Hon. Mr. Campbell's ab- Q

flowing Offering."

Hymns, 102, ‘I37. 461. 405.

Music:

2.30 p. m. Sabbath School Bible Classes. in the Bible School.

Sta -----—

EVENING MUSIC

Mrs. F. A. Match.)

ever.“ Psalm 106:1.

and Your attendance will be welcomed Anthem-"Jesus. My Strength. my

Mark (solo part by Min Lorena Sempel

1.00 p. m. Theme: "A Modern View

Fitzroy Street, Nov. 10th, and gave Marlon lvmcKlnnon a miscellan- eous shower. The bride-to-be was ushered to a decorated chair. Lit- tle Lorraine Cudmore and Jackie

g Quinn dressed as bride and groom

wheeled in s. dworsted dolls car- riage laden with lovely gifts. The verses and best wishes accomp< shying the gifts were read by Miss Evelyn MacGlllivray. De- lightful music was fumlshed by

ed and a dainty luncheon served by the hostess. The party was

the morning service tomorrow. the

BUYS SHOW HORSE — count Mesh, one of the best known show horses in the Maritime Provinces, has been purchased by Dr. A. E. Mackintosh, of Amherst, from Pr. R. F. Seaman, of Charlottetown. Count Meeh was one of the lead- ing prize and money winners at the Maritime Winter Fair. placing well up among the Jumpers and saddle horses as well es in Th6

roadster classes. At the Dfﬂmﬁ

*""'°'"‘-";? £321!“ U; f,“ Mr. George Chopnell assisted by time this newly acquired 1133s: is fl Rate »- From Charlottetown - $20.40. ""10 ° -- ° °“ M . n n dM.J m in th tables of Johnny w. - - (mien. by Mn Arthur llnper and A‘ $21,‘: was‘ elf“; m Axflhirsh m Wm be “m, m, Sleeping and parlor accommodation extra.

Miss Betty Mackintosh. one o! the iendins iedv 11w‘ °’ ‘hi’ WW!!- I-ler own mare. Vanity, purchased

Campbell will leave this mcrnin!

h t nio groups. from iiuizrlglattlflmllnoeillisteiy st the close

Store. Water Street Summersider III The Author, at Charlottetown.

the Secretary of State. While 'i=ne~f'<of

TEN DAY EXGIIRSIUN T0 MONTREAL

y; Going — Tuesday, November 23rd. Returning-Any day up to and including Friday, Dec. 3rd.

“I. M59“?-

L“

T. B. ROGERS

2.30 I’. fW-Fumliiy- Svhiml nliil Ilihlc (‘knew r.

A. ROY maxim rum, i..n.._\..\i., .\.A.r:.(r.-<>r;nn=_.,_

I \ r I r 0f 91-" l brought to s. close by singing “For , i, Hymns: s63. 265. 541- x She's A Jolly Good Fellow." (Pat- in Halifax in 1936. was taken Over r _ _ __ ' 1"» . . , . _ . _' "Pram y‘, u“, 14mg,’ oﬂg-ive i r101», please copy). by SeamarL-Moncton ‘Trans- City Tlcket Agent (,,gn_ Nat” R3 g, Till-I 513D.“ NEXT BETORF ADVFNT ,- thanlis unto the Inrd: or e I OYP- , .[ 11.00 A. I\I.-—T\I ‘ I’ . l Senor "siiiklrw a 12:‘ good; roi- His mercy endureth for i Mnmbiremer 181 Queen Street Phone 540 ,.,,",.',‘;;;;5, ,{:,‘_1',',,.,§l" '" é THE BAPTIST Gunmen» -' Al‘ GOING To i Oﬂcrtnry Anthcm-"Rigloiro tircrtily" -- —- Wumlivard i-.

prom.‘ l. . iffmﬂmﬁ°°“““ on of the Rev. n. L. Denion, for Ottawa to attend the Dornin- . _ a S . , -r,,,. My". . limit; will be “Justice, Bread, Lib- ion-Provincial oonfarcncteiogn otgioiéll-e ‘ h": ‘ _ m,“ ‘ f"'||'?\':,_d hi.‘ .r,,,,',,,,,,n,,,,,_ 5: ' 011%" The third of a series of ad‘ puny Law’ B‘ con mm - ‘ Asitlirm-“Nn Slizulnivs Ymiilor" — — - ~ - - (iruil Th BAPTIST Churc W? vii e e and Htlroy '3 ' ~ - 1 _ I i . . - evening service, the theme for this ' ~ Itllv. II. n. Ru Minn, M. .\., neemr. _ MINISTER-THE REVJL hDENT0N'B' n g Manon lmdlg ltgxlzamthe pesggilgl r; A“ Ideal Chrmm" Gm- 99 The presbylerlan Church h] Lanada ofllliilﬁl—llls§ I.ll.I.I.\N i:.iRl.i:. .3: ggllefltllliailltit?‘ period on Thurgdgy TRIGS Abegwelt Choli- nirr-eirrr-nlii. .\l,l'.l-Iil'i‘ DINNIS. .3 afternoon from three w six o'clock s New Bunk of Old Times Q ‘Yoga; _ ‘c,’ _M___‘_“:KQV,JV‘ ‘ 4W I in the Church Study with door on, in ~,. ' '" ' " ' '-">»’~‘°Iuoo-2 Fitzroy Street. If you have any P?!" msnd Ill-story. ‘Tradition a Humour soiml problem which you would like (Emmy mutt-m‘) W 4 _ _ is discuss in conﬁdence with ltllt: h, i, ‘ODYDbOO-t» . » someone‘ minister of this congregation. W18- BENJAMIN BREMNER I‘ ' , , , thcr you are a resident of Char- l L” .5. . ' _ icttciown or not. you are cordially F s I réiﬂtr a‘ co “a Trinity Ulillljij Cllll J Cl] "Wmd t” make use of this servim M ollhna gtalioncrs. Ltd chrriietie: All senior members oi thé Qfngbff , " . rri, Bell Book "st Novelty IZICV. Illtll mu l-‘ii, I\l. s, n. ll.~~I\Iriii\lrr 81110" a" "lvmd m mm‘ Wm ‘ °'"" ° ‘ Iriav. /\. ii. .\l;l(‘l( 7.11), n. A. mnm Muir m.

1Q®36

N Sunnyslde, Beauty

and

Chiropody Parlor

10o Grafton st.

1 ser ice. Life prob- ‘giggling’: by the International or the day are discussed.

Eastern Guardian

"eﬂﬂﬂl OI-IPTIONSJ ti: onn-iomwwn Guard!» Y handed to their moi. Archie Hume.

St. James Church

Minister: Rev. It. MOORHEAD LEGATE, D, D. Public Worship:

MORNING WORSHIP II 013L095

e, 7-. gg‘ wlmmaeamoucwaacoc-woorocccsaceeeeecseecescscccnwwﬂ e"

Bennon-"Justice, Bread. Liberty” .3308!!! HOOD H.017‘! gala‘! (Over Clllsdlan Stores) The Itev. I1. L Benton Chou. Ollitlﬂltitll. Moreh {isles o I I _____ MORNING AT ELEVEN, AND EVENING AT SEVEN

Anthem-Selected — -. — - " _ _ _ _,__ e ,|_ bread rom sec . I . GCLOCK

Oflln Prelude-Prelude on St. Colurnlw-ltob‘ Mll 9' electrically i Reduced Due" on a“ new]; - THE MINISTER

Solo-“Greeis Paetnr ‘K-ﬂenderloll. JTIMUG“ °“' h“, 100%; our Permanents for the tr- _ -

m” qiianrllilliitcii scnooi. eaor M Erihﬁeirrlrinriryrmnrfevlirkinsmherei remainder of Novcm- smd_"——__—_.y sch”, u Twomm,’ 11.00 snL-rrrhiie Worship.

- ' , l . _ .

‘r m" “w."""i:..".*r.:':'.r::.:::.n' “n; " an .::"...::.i:'."if.°r‘r 6111i? "°"r.r“i'“‘rr;’r' ‘liiitt; Mornlnl h... "

eemion Invite sll sen o mem o - f, me 1' _ mac ne . l‘ = Ilcv, "Ugh Miner- _ nd that is fine hardwood saw Ants : "'1' DeumK-Dykes.

"m" w Whine woltsiilr 1 0111001‘ awe use no cure; urging. a limlﬂliy- Eveninl grille: a ' srriherrn-"rhe Lord ls My shepherd" ~— — ihildilr"

2"“ Wad‘; .. Th, Rev ii i.. nenton 5&3‘ reginiil-lgijtgtiatw-iei mi- Sasig " CHIROPUDY " miligsntrlxsmlide; $1123: hie-Primer. 2.30 r. lVI.-—Sunday srhnni and mhie (‘lnssi-I.

°""°“"' m!’ "' “""" ’ ' seven ' 4543-11-9-11-18-16-1 - . . ' ' ' ' This is the third oi’ s series of addresses on umned‘ I L -~— “h Electric or n‘ m “em. "I moo l,_ M_l.ub“c “.0r5hip_ 5'"- ch ir snto-rrsrows " ' '1" m" urrritmmrfifrlwir?“ ia-be-ll mJlih-e-che; ir-ireetzr. [wiggling wiilcgs receivlnl W1" Treatment” Chon- umern-Mm 3' A' L""“‘ ser-rrrnrr - "wnsr PLACE no WE oivs Jssrs era . co llﬂ " 1 - r ~ _~- _ _ ___ _ __ -_ Mme

Missllelen crriiheeihornolli- I r i senate m‘ D°°°mb°',;§,11“b':,§ .‘.‘,’..‘.“‘e'., lie Phone 612 ﬂocfrmlt“; d ‘m. _ _ _'f_°_‘_"f_"f_ Gm;

Organ Proliﬁc-Allegro and Andante-Fr: cludiﬂl "xv-hi mu" b. m w, STMNGE“; AND "M1035 503915“; Anthcm- as c n r - Mengemﬁn‘ I n__G.b|-|¢] dist. s later than ‘mudsy MAE SMITH ‘NWTED’ ' Visitors and Students Cordislly Welcome.

o An venh P!!!" ' ~ 1"8.""‘ Mnwhflisliungtlall. Fletcher “iirimriivuiirirri.” 31in Ibzllgffeinfgiiwtl: u“ A‘ ‘momma! Mvrﬂlﬂl 5mm 5“”“‘°"' l" °' "' c’ Y‘ n crn-"Crossing e l‘ ~"' ‘h I ' “m _ _ vrr-eme-emr» o» 1-“ "m" '............... i - '

rns nsrnsr on"

I“